(data stored in ACNUC7421 zone)

EMBL: CP002160.PE61

CP002160.PE61        Location/Qualifiers
FT   CDS             105751..107247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0063"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="KEGG: dhd:Dhaf_2889 carboxypeptidase Taq; PFAM:
FT                   peptidase M32 carboxypeptidase Taq metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49852"
FT                   /db_xref="GOA:D9SMR7"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR7"
FT                   /inference="protein motif:PRIAM:3.4.17.19"
FT                   /protein_id="ADL49852.1"
FT                   /translation="MNKSLNDFKDHLKKIEYLKSTIALLHWDLVVKAPEKSVDYRSDML
FT                   GYLSSEEYKLTTGEAMKGFLDVFSTSKDNDDIINAMIRTAKKNYDRVRKIPEDMYKAYT
FT                   IDASKSTNAWEEAKEKNDFSIFYPHLVKMVEYKRNFSKYFGYKDNIYDALLDEYEPNAT
FT                   VKDIDKYFSELKEGIIDILRRVEKSKVNINDDFLKTFFAKEDQKKFTEFILDKMGYDYV
FT                   SAGRIDESIHPFTTNFGNKDVRITNHYHENDFVSAVFSAIHEGGHAIYEQNISDDLIGT
FT                   GLAMGVSMGIHESQSRFYENIIGRSKGFWKFFFPEAKKRFPQFKNVSFDDFYRAINKVQ
FT                   CSLIRIEADELTYSLHIIIRYEIEKMLINGEIEVKDLPSVWNDKYEEYLGVRPDNDAVG
FT                   VLQDVHWSDGSFGYFPSYALGNIYGAQLLIKIEKEIDDMYAKIEQGELSEIKSWLKENI
FT                   HKYGAIYEPRILLEKITGERLKPKYFLDYLRKKYEEIYEL"
     MNKSLNDFKD HLKKIEYLKS TIALLHWDLV VKAPEKSVDY RSDMLGYLSS EEYKLTTGEA        60
     MKGFLDVFST SKDNDDIINA MIRTAKKNYD RVRKIPEDMY KAYTIDASKS TNAWEEAKEK       120
     NDFSIFYPHL VKMVEYKRNF SKYFGYKDNI YDALLDEYEP NATVKDIDKY FSELKEGIID       180
     ILRRVEKSKV NINDDFLKTF FAKEDQKKFT EFILDKMGYD YVSAGRIDES IHPFTTNFGN       240
     KDVRITNHYH ENDFVSAVFS AIHEGGHAIY EQNISDDLIG TGLAMGVSMG IHESQSRFYE       300
     NIIGRSKGFW KFFFPEAKKR FPQFKNVSFD DFYRAINKVQ CSLIRIEADE LTYSLHIIIR       360
     YEIEKMLING EIEVKDLPSV WNDKYEEYLG VRPDNDAVGV LQDVHWSDGS FGYFPSYALG       420
     NIYGAQLLIK IEKEIDDMYA KIEQGELSEI KSWLKENIHK YGAIYEPRIL LEKITGERLK       480
     PKYFLDYLRK KYEEIYEL                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page