(data stored in ACNUC7421 zone)

EMBL: CP002160.PE62

CP002160.PE62        Location/Qualifiers
FT   CDS             107781..108707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0064"
FT                   /product="Ribosomal-protein-alanine N-acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="KEGG: cac:CAC0152 ribosomal-protein-alanine
FT                   acetyltransferase (acetylating enzyme for N-terminal of
FT                   ribosomal protein S5); PFAM: GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49853"
FT                   /db_xref="GOA:D9SMR8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR8"
FT                   /inference="protein motif:PRIAM:2.3.1.128"
FT                   /protein_id="ADL49853.1"
FT                   /translation="MNGQYVTIEVVKSLEREYLIKDKLGISLGRFFVLEFNKDNRFSML
FT                   KVTLYKDEIPVAFKEAITLMLQWLFIKNKMLKVTFLIEEDQDIQVFVDLSFDLEGVITN
FT                   SLVEEEYKSLFLFGIDKNQYFKRGITNNLVLKNDDIVLKLLTPEYSKNMLDYYVRNKNH
FT                   LKPFEPMRDEYFYTLAAQRKLLIDGYNQYMNGTAIGFGIFKDDKLIGRLQCSNIVQGVF
FT                   KNGIVGYSIDVEYQGRGYMKQAMKLFSELAFSDLELHRLEATTLIDNIKSQKVLLACGF
FT                   EEVGISKKYLFINGKWRDHKIFALIRE"
     MNGQYVTIEV VKSLEREYLI KDKLGISLGR FFVLEFNKDN RFSMLKVTLY KDEIPVAFKE        60
     AITLMLQWLF IKNKMLKVTF LIEEDQDIQV FVDLSFDLEG VITNSLVEEE YKSLFLFGID       120
     KNQYFKRGIT NNLVLKNDDI VLKLLTPEYS KNMLDYYVRN KNHLKPFEPM RDEYFYTLAA       180
     QRKLLIDGYN QYMNGTAIGF GIFKDDKLIG RLQCSNIVQG VFKNGIVGYS IDVEYQGRGY       240
     MKQAMKLFSE LAFSDLELHR LEATTLIDNI KSQKVLLACG FEEVGISKKY LFINGKWRDH       300
     KIFALIRE                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page