(data stored in ACNUC7421 zone)

EMBL: CP002160.PE65

CP002160.PE65        Location/Qualifiers
FT   CDS             116822..117478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0067"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: str:Sterm_0367 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49856"
FT                   /db_xref="GOA:D9SMS1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS1"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL49856.1"
FT                   /translation="MKDDEIVNITMEYVKDKLEGEGSGHDWWHIYRVYNNALKIAKNEG
FT                   VGDLFVIKLASLLHDIADWKFYNGDVTVGYKETKKWLVNFNLDEQLIEHVARIVKDISY
FT                   KGAGEASLMNTIEGKIVQDADRLDAIGAIGIARTFAYGGNKNKEMYNPNIKPVFHENFQ
FT                   QYKNSNGTVINHFYEKLLLLKDLMNTEGGKKYAEERHTFMEAFLEQFYSEWNVNE"
     MKDDEIVNIT MEYVKDKLEG EGSGHDWWHI YRVYNNALKI AKNEGVGDLF VIKLASLLHD        60
     IADWKFYNGD VTVGYKETKK WLVNFNLDEQ LIEHVARIVK DISYKGAGEA SLMNTIEGKI       120
     VQDADRLDAI GAIGIARTFA YGGNKNKEMY NPNIKPVFHE NFQQYKNSNG TVINHFYEKL       180
     LLLKDLMNTE GGKKYAEERH TFMEAFLEQF YSEWNVNE                               218
//

If you have problems or comments...

PBIL Back to PBIL home page