(data stored in ACNUC7421 zone)

EMBL: CP002160.PE67

CP002160.PE67        Location/Qualifiers
FT   CDS             118478..119518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0069"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   cac:CAC0214 aminopeptidase M42 family endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49858"
FT                   /db_xref="GOA:D9SMS3"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS3"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49858.1"
FT                   /translation="MNYQLLLRELCSENAPSGLEFKLHPIMEKNFGYIKDLEISKDENY
FT                   NLYINKKGKRNGTIMIMAHSDEISLVITEVIEGGFLRFKAIGMDANILLGQEVAIHGCE
FT                   VINGVIGGIPKSKTDDNILKKAVVTSDLFIDTGYPKEYLEEVIKIGDRATLIGEYKNLL
FT                   RNTISSKAIDDRAGILSMLICAQELKEHELDVVFVCSCQEELGHRGAKMASYKVKPNLA
FT                   IAIDVTFDNGEFGDRDRENKLGNGPIICIGPNNHPRMIKKLKEVARKYYIPFGVEVEPG
FT                   NTGSDAWDIQVSRGGIPTVLVSIPIKYMHTSVETANLGDIKNTGRLVARFIEEIKLLDL
FT                   EELTCF"
     MNYQLLLREL CSENAPSGLE FKLHPIMEKN FGYIKDLEIS KDENYNLYIN KKGKRNGTIM        60
     IMAHSDEISL VITEVIEGGF LRFKAIGMDA NILLGQEVAI HGCEVINGVI GGIPKSKTDD       120
     NILKKAVVTS DLFIDTGYPK EYLEEVIKIG DRATLIGEYK NLLRNTISSK AIDDRAGILS       180
     MLICAQELKE HELDVVFVCS CQEELGHRGA KMASYKVKPN LAIAIDVTFD NGEFGDRDRE       240
     NKLGNGPIIC IGPNNHPRMI KKLKEVARKY YIPFGVEVEP GNTGSDAWDI QVSRGGIPTV       300
     LVSIPIKYMH TSVETANLGD IKNTGRLVAR FIEEIKLLDL EELTCF                      346
//

If you have problems or comments...

PBIL Back to PBIL home page