(data stored in ACNUC7421 zone)

EMBL: CP002160.PE68

CP002160.PE68        Location/Qualifiers
FT   CDS             119509..120471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0070"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   ckr:CKR_3367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49859"
FT                   /db_xref="GOA:D9SMS4"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS4"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49859.1"
FT                   /translation="MLLERLSELVAPSGYEDEVRNFIVNELNGKVDSLNSDKMGNVIAN
FT                   KNGKRKKIIISTHMDETGFIITGFNKEGTLRIASLGDENRDMVSKGVLVGTKKLLGVIG
FT                   AKAIHLQTKEERSKSITLDRCCIDIGAETEFESREYIELGDFAVYDTRFQEMGTNRLKG
FT                   KGFNGRVGCSMLIELLQESESNNIQGIFTTQSLVGYRGAYAAAYELEGDLLINLDVVES
FT                   TDLPGVDDVNISIDKGPVLYLKEKNRDIRALAEKIGIPYQLINDKIYNDSNAYKMELMS
FT                   TNVINILVPCRYVDSYASIISKKDYEDTKNLINSFLKEN"
     MLLERLSELV APSGYEDEVR NFIVNELNGK VDSLNSDKMG NVIANKNGKR KKIIISTHMD        60
     ETGFIITGFN KEGTLRIASL GDENRDMVSK GVLVGTKKLL GVIGAKAIHL QTKEERSKSI       120
     TLDRCCIDIG AETEFESREY IELGDFAVYD TRFQEMGTNR LKGKGFNGRV GCSMLIELLQ       180
     ESESNNIQGI FTTQSLVGYR GAYAAAYELE GDLLINLDVV ESTDLPGVDD VNISIDKGPV       240
     LYLKEKNRDI RALAEKIGIP YQLINDKIYN DSNAYKMELM STNVINILVP CRYVDSYASI       300
     ISKKDYEDTK NLINSFLKEN                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page