(data stored in ACNUC7421 zone)

EMBL: CP002160.PE70

CP002160.PE70        Location/Qualifiers
FT   CDS             120802..121677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0072"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   cno:NT01CX_0791 aminopeptidase M42 family endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49861"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS6"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADL49861.1"
FT                   /translation="MDKLFYDISKAFGVDREISEVKAVIREYIEKKHICIYEDEVGNLI
FT                   VKLGTGNKKLLMSALMNRCGYMAVKIDNEESGKVEINGTNIEPKLDGKYLRTKGGAIAR
FT                   IHDGDKIDILVGQIQAGEFLMIDEEIRVFDNKVSGVEVSNISLIYSLIKVIEEVNIKDK
FT                   EVYFVFSYKEDSIFKSNFAAKAIRPDRALFFDSSQNSDKLQLIYMNRKYLANESFKQDI
FT                   LNIAKENDIDITLKDCIDETEADSIHKEVGGIATVVLGLPCKYKNTSLQIIERVAIEEM
FT                   RKLLKEIIEG"
     MDKLFYDISK AFGVDREISE VKAVIREYIE KKHICIYEDE VGNLIVKLGT GNKKLLMSAL        60
     MNRCGYMAVK IDNEESGKVE INGTNIEPKL DGKYLRTKGG AIARIHDGDK IDILVGQIQA       120
     GEFLMIDEEI RVFDNKVSGV EVSNISLIYS LIKVIEEVNI KDKEVYFVFS YKEDSIFKSN       180
     FAAKAIRPDR ALFFDSSQNS DKLQLIYMNR KYLANESFKQ DILNIAKEND IDITLKDCID       240
     ETEADSIHKE VGGIATVVLG LPCKYKNTSL QIIERVAIEE MRKLLKEIIE G                291
//

If you have problems or comments...

PBIL Back to PBIL home page