(data stored in ACNUC7421 zone)

EMBL: CP002160.PE71

CP002160.PE71        Location/Qualifiers
FT   CDS             121684..122133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0073"
FT                   /product="VanZ family protein"
FT                   /note="KEGG: ckr:CKR_3365 hypothetical protein; manually
FT                   curated; PFAM: VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49862"
FT                   /db_xref="GOA:D9SMS7"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS7"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADL49862.1"
FT                   /translation="MTKRNISWTLMIVWMAFIFYMSSKNGNDSNEMSNVVINTLRYMGI
FT                   DENRTLQSILTFLVRKSAHILEYCILAWFIFNVAKEYNNLIASSVFTLILSVLYATTDE
FT                   IHQLYIPGRSGKMTDVLIDSIGICMGVAISYFVHKRIYSRKKIKD"
     MTKRNISWTL MIVWMAFIFY MSSKNGNDSN EMSNVVINTL RYMGIDENRT LQSILTFLVR        60
     KSAHILEYCI LAWFIFNVAK EYNNLIASSV FTLILSVLYA TTDEIHQLYI PGRSGKMTDV       120
     LIDSIGICMG VAISYFVHKR IYSRKKIKD                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page