(data stored in ACNUC7421 zone)

EMBL: CP002160.PE72

CP002160.PE72        Location/Qualifiers
FT   CDS             128580..129368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0074"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: cpr:CPR_0552 transcription repressor of
FT                   fructose operon FruR; PFAM: regulatory protein DeoR; SMART:
FT                   regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49863"
FT                   /db_xref="GOA:D9SMS8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS8"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADL49863.1"
FT                   /translation="MNDLGYSCKWGVKMLIEERKSRILNLLKERDVVTIPELIDSLQVS
FT                   EATIRRDLAYLDSINALKRVHGGATAMKKSLIEPTYNEKQNINVDDKKAIAKYAASLVE
FT                   NGDSIYLDAGTTTYEMVPYLEGKDIVVVTNGLKHIELLIESKIEAYIIGGKIKSSTKAV
FT                   VGIEAIRNLERYKFDKSFLGINGIHLIHGYTTPDAEESTLKEMAMKASKESFVLADESK
FT                   FGQQYFMQVASLDKASIITSSSTNFGEYSKLTEIRKVEEE"
     MNDLGYSCKW GVKMLIEERK SRILNLLKER DVVTIPELID SLQVSEATIR RDLAYLDSIN        60
     ALKRVHGGAT AMKKSLIEPT YNEKQNINVD DKKAIAKYAA SLVENGDSIY LDAGTTTYEM       120
     VPYLEGKDIV VVTNGLKHIE LLIESKIEAY IIGGKIKSST KAVVGIEAIR NLERYKFDKS       180
     FLGINGIHLI HGYTTPDAEE STLKEMAMKA SKESFVLADE SKFGQQYFMQ VASLDKASII       240
     TSSSTNFGEY SKLTEIRKVE EE                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page