(data stored in ACNUC7421 zone)

EMBL: CP002160.PE75

CP002160.PE75        Location/Qualifiers
FT   CDS             133052..134662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0077"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ctc:CTC00987 stage V sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49866"
FT                   /db_xref="GOA:D9SMT1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT1"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADL49866.1"
FT                   /translation="MEKQSTTKGFAILTVATMLGKIFSLLYLPFLIRVLADEGYGIYQA
FT                   TYTVFLFIYGLTSTGISTAVSKYISELTALENYKAVKRAFKLTMLLMFLLGLFMTLVLA
FT                   FGAKFFANFTEFDEAKISLITLSPTIFLTAVVSVYRGYFQGSHYMTPTAISQVIEQIAN
FT                   VFFSILFAYLWMPKGVEWGVAGATIGTPLGALAALMYLHVVYIKRAKIKMPQSSKIVKA
FT                   IRNKTIVKNIVNIALPIAISQGVINAAFIVDTKIVMSRLMVAGFSKNEATILFGILAKY
FT                   NTLSNVPIAIIIALSTSVLPSIAAVIATNNTKAAVAKINYSIKLCLLVAVPCTVGLSAL
FT                   SEPIYRLLLGQGHELMMYGSFIIIIWSLVQIHITILQSINKMYVATILMVIGLIPKILL
FT                   DYILVVNIHLHIYGVLIANLVYYALPLFLMRNYMRNKLKLRVKILSQFIKPCIASLWMG
FT                   IAGILSYNGFFKALHIVLPYKLSILIAVSIAIIIAAYLYVTILIFSGVITERDINSISP
FT                   KIKKLLPKILRRKLIKQTA"
     MEKQSTTKGF AILTVATMLG KIFSLLYLPF LIRVLADEGY GIYQATYTVF LFIYGLTSTG        60
     ISTAVSKYIS ELTALENYKA VKRAFKLTML LMFLLGLFMT LVLAFGAKFF ANFTEFDEAK       120
     ISLITLSPTI FLTAVVSVYR GYFQGSHYMT PTAISQVIEQ IANVFFSILF AYLWMPKGVE       180
     WGVAGATIGT PLGALAALMY LHVVYIKRAK IKMPQSSKIV KAIRNKTIVK NIVNIALPIA       240
     ISQGVINAAF IVDTKIVMSR LMVAGFSKNE ATILFGILAK YNTLSNVPIA IIIALSTSVL       300
     PSIAAVIATN NTKAAVAKIN YSIKLCLLVA VPCTVGLSAL SEPIYRLLLG QGHELMMYGS       360
     FIIIIWSLVQ IHITILQSIN KMYVATILMV IGLIPKILLD YILVVNIHLH IYGVLIANLV       420
     YYALPLFLMR NYMRNKLKLR VKILSQFIKP CIASLWMGIA GILSYNGFFK ALHIVLPYKL       480
     SILIAVSIAI IIAAYLYVTI LIFSGVITER DINSISPKIK KLLPKILRRK LIKQTA           536
//

If you have problems or comments...

PBIL Back to PBIL home page