(data stored in ACNUC7421 zone)

EMBL: CP002160.PE76

CP002160.PE76        Location/Qualifiers
FT   CDS             134700..135791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0078"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: cno:NT01CX_0623
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49867"
FT                   /db_xref="GOA:D9SMT2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT2"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADL49867.1"
FT                   /translation="MSSVWGNIMKVSLFGESQGDIIGVTIHGIPSGVKLDLEFIKKEMK
FT                   RRLSGNYNVATPRQEDDEFIITTGYFNGYTTGAPLTATIKNKDIKQADNDEFKDKMRPS
FT                   FGDYTEHLRYNGFNDYRGGGHHSGRLTAPLLFAGAVAKLILKEKNIVIGAHILKIADIF
FT                   DEVFDKVNVSEELLKSLPEKLFPVIKDDMGLIMQTEILKAKYQKDTIGGIVECAAINIP
FT                   GGVGNPFFDSMESVISHLLFSIPSIKAVEFGEGFNIANLRGSQANDQMYMEGDKVKTYT
FT                   NHSGGIVAGITNGMPIIFRVAVKPPPTIAKPQKTVDISTKENTTVDTVSAHDPSMIHRI
FT                   VPVIEGVTALAILDSILSGNNHI"
     MSSVWGNIMK VSLFGESQGD IIGVTIHGIP SGVKLDLEFI KKEMKRRLSG NYNVATPRQE        60
     DDEFIITTGY FNGYTTGAPL TATIKNKDIK QADNDEFKDK MRPSFGDYTE HLRYNGFNDY       120
     RGGGHHSGRL TAPLLFAGAV AKLILKEKNI VIGAHILKIA DIFDEVFDKV NVSEELLKSL       180
     PEKLFPVIKD DMGLIMQTEI LKAKYQKDTI GGIVECAAIN IPGGVGNPFF DSMESVISHL       240
     LFSIPSIKAV EFGEGFNIAN LRGSQANDQM YMEGDKVKTY TNHSGGIVAG ITNGMPIIFR       300
     VAVKPPPTIA KPQKTVDIST KENTTVDTVS AHDPSMIHRI VPVIEGVTAL AILDSILSGN       360
     NHI                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page