(data stored in ACNUC7421 zone)

EMBL: CP002160.PE77

CP002160.PE77        Location/Qualifiers
FT   CDS             135947..136375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0079"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   KEGG: cac:CAC0899 3-dehydroquinate dehydratase; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49868"
FT                   /db_xref="GOA:D9SMT3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT3"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ADL49868.1"
FT                   /translation="MKFLVLNGPNINMLGTREKGIYGQDNYETLCKIIEEKAKEINVEV
FT                   DVRQSNSEGALIDIIHDTLGKYDGIVINPGAYTHYSIAIYDALLAVNLPTIEVHISNIH
FT                   KREEFRHKSVTAAACIGQIVGLGLQGYALAIQALKQRL"
     MKFLVLNGPN INMLGTREKG IYGQDNYETL CKIIEEKAKE INVEVDVRQS NSEGALIDII        60
     HDTLGKYDGI VINPGAYTHY SIAIYDALLA VNLPTIEVHI SNIHKREEFR HKSVTAAACI       120
     GQIVGLGLQG YALAIQALKQ RL                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page