(data stored in ACNUC7421 zone)

EMBL: CP002160.PE78

CP002160.PE78        Location/Qualifiers
FT   CDS             complement(136472..138031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0080"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; Rieske [2Fe-2S]
FT                   iron-sulphur domain; KEGG: cth:Cthe_1461 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49869"
FT                   /db_xref="GOA:D9SMT4"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT4"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADL49869.1"
FT                   /translation="MDNQEFLKSFPESFWMASTNATDYPSLDQDISVDIAIIGGGITGI
FT                   SCAYSLKDEGFKIAILEADHIAQGASGHTTAKVTSQHGLIYNKTKLQLGEELAKQYAEA
FT                   NEHAIQRIKSIIDTHHIDCDYKTESAFIYTQQDNYVQKIYNEIATASDLGIKASFVDNI
FT                   PFPIDIKAAVRFDDQGQFHPRKYLLALAKEITNSNCTIYEKTRIVGIDESNKYTLTTER
FT                   GNKITADKVIIASHYPFYNKQAMYFARLYCERSYALAVKAKEKYPGGMYLSAEDPKRSL
FT                   RLINSPNGDLIMVGGETHKTGQSKDTFKHYEAIMNFANGIFTVEDIPYKWSAQDCITVD
FT                   DIPYVGKYIANSPNLYVATGFRKWGMTNSMAAAIIIKDLIVVGKSPWQDVYNPSRKTII
FT                   ASAKNFVVENFNVAEELLGGKLSPLPEDIFLEPDEGKLVKINDERIGVYRDEHCKLHKV
FT                   NTTCTHMGCELNWNSAERTWDCPCHGSRFSHKGDIVEGPAVKPLSFDNNVNTIGKLLNE
FT                   DF"
     MDNQEFLKSF PESFWMASTN ATDYPSLDQD ISVDIAIIGG GITGISCAYS LKDEGFKIAI        60
     LEADHIAQGA SGHTTAKVTS QHGLIYNKTK LQLGEELAKQ YAEANEHAIQ RIKSIIDTHH       120
     IDCDYKTESA FIYTQQDNYV QKIYNEIATA SDLGIKASFV DNIPFPIDIK AAVRFDDQGQ       180
     FHPRKYLLAL AKEITNSNCT IYEKTRIVGI DESNKYTLTT ERGNKITADK VIIASHYPFY       240
     NKQAMYFARL YCERSYALAV KAKEKYPGGM YLSAEDPKRS LRLINSPNGD LIMVGGETHK       300
     TGQSKDTFKH YEAIMNFANG IFTVEDIPYK WSAQDCITVD DIPYVGKYIA NSPNLYVATG       360
     FRKWGMTNSM AAAIIIKDLI VVGKSPWQDV YNPSRKTIIA SAKNFVVENF NVAEELLGGK       420
     LSPLPEDIFL EPDEGKLVKI NDERIGVYRD EHCKLHKVNT TCTHMGCELN WNSAERTWDC       480
     PCHGSRFSHK GDIVEGPAVK PLSFDNNVNT IGKLLNEDF                              519
//

If you have problems or comments...

PBIL Back to PBIL home page