(data stored in ACNUC7421 zone)

EMBL: CP002160.PE79

CP002160.PE79        Location/Qualifiers
FT   CDS             complement(138297..138554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaO19.9219 similar to S. cerevisiae TOM6
FT                   mitochondrial outer membrane translocase component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49870"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT5"
FT                   /protein_id="ADL49870.1"
FT                   /translation="MRHKITLSIQPSVKEKGQQRADEMFSGNFSMYITYLINKDVKGII
FT                   ETPIYRNDLSSNIPPKQENDAYEKRKDEIACAIDNILGID"
     MRHKITLSIQ PSVKEKGQQR ADEMFSGNFS MYITYLINKD VKGIIETPIY RNDLSSNIPP        60
     KQENDAYEKR KDEIACAIDN ILGID                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page