(data stored in ACNUC7421 zone)

EMBL: CP002160.PE8

CP002160.PE8         Location/Qualifiers
FT   CDS             15174..15683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0008"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: ctc:CTC00088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49799"
FT                   /db_xref="GOA:D9SML4"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML4"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL49799.1"
FT                   /translation="MGIKRVRQFVIQLTDTMREEDYIYVNKYLTSKETIIFRKLSKNDQ
FT                   KHCVRVAKGLENIIIEKCGDNYNKAEIIKYIRLGLLHDIGKSFKKVNVINKSVLVMLNS
FT                   LTKGKLIKFVNIKSIDCYYNHGEKGYEMLKDQCDDKEFLQVIRYHHNRNYNNVAVKLLR
FT                   DIDDKN"
     MGIKRVRQFV IQLTDTMREE DYIYVNKYLT SKETIIFRKL SKNDQKHCVR VAKGLENIII        60
     EKCGDNYNKA EIIKYIRLGL LHDIGKSFKK VNVINKSVLV MLNSLTKGKL IKFVNIKSID       120
     CYYNHGEKGY EMLKDQCDDK EFLQVIRYHH NRNYNNVAVK LLRDIDDKN                   169
//

If you have problems or comments...

PBIL Back to PBIL home page