(data stored in ACNUC7421 zone)

EMBL: CP002160.PE80

CP002160.PE80        Location/Qualifiers
FT   CDS             complement(138544..139431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0082"
FT                   /product="StbA family protein"
FT                   /note="PFAM: StbA family protein; KEGG: cbe:Cbei_5015 StbA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49871"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMT6"
FT                   /inference="protein motif:PFAM:PF06406"
FT                   /protein_id="ADL49871.1"
FT                   /translation="MIMGIDVGYSHTKVYTSNGRDIFRSTVTNGIMDINVNAIKVKIAG
FT                   NEYTVGENTGNFSVKLNKIDDAVFRLCLYTAVARNLPIGEDEVQLVIGLPVQYYKDQKL
FT                   ELKKALEGIQVFLSLNDKPIRFKITKCVVFPQSAGVFVLHPDIFEGSNIVIDIGGMTVD
FT                   VSYFNDMTLQDYRTYELGMIKLYDKLVQNIKAEFGVSYDILNAEDIIKNKRIFRDGELI
FT                   DCTDVVNTTLRTHASLIINRVMAGLSQYDTSQRHFIGGGSYILGEYLPVKAIKEDIYAN
FT                   AEAFFKIGVERFAS"
     MIMGIDVGYS HTKVYTSNGR DIFRSTVTNG IMDINVNAIK VKIAGNEYTV GENTGNFSVK        60
     LNKIDDAVFR LCLYTAVARN LPIGEDEVQL VIGLPVQYYK DQKLELKKAL EGIQVFLSLN       120
     DKPIRFKITK CVVFPQSAGV FVLHPDIFEG SNIVIDIGGM TVDVSYFNDM TLQDYRTYEL       180
     GMIKLYDKLV QNIKAEFGVS YDILNAEDII KNKRIFRDGE LIDCTDVVNT TLRTHASLII       240
     NRVMAGLSQY DTSQRHFIGG GSYILGEYLP VKAIKEDIYA NAEAFFKIGV ERFAS            295
//

If you have problems or comments...

PBIL Back to PBIL home page