(data stored in ACNUC7421 zone)

EMBL: CP002160.PE87

CP002160.PE87        Location/Qualifiers
FT   CDS             complement(154943..155800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0089"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   KEGG: cbk:CLL_A2856 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49878"
FT                   /db_xref="GOA:D9SNK7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK7"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ADL49878.1"
FT                   /translation="MKIKDILDNRQSFSVELFPPKKTDSFDNIINTLDNLNGLDIDFVS
FT                   VTYGAGGSSRDNTVKLSKKIKSEYNLEVITHLTCINSKKDEIASLLDEMKENNLENILA
FT                   LRGDIPSEVIYDDYKYASDLIPEIKSLGDFCVGAACYPEKHPEAPSNVYDIKKLKQKTA
FT                   LGCDFLISQLFLDNTMFFNFQERLELADVNTKVLAGIMPVINKAQFERIIQLSGCNVPP
FT                   KFKKILEKYEHNPSALKDAGIAYAIDQIIDLMCHDVDGIHLYIMNKPENAKRILDNITG
FT                   LRNA"
     MKIKDILDNR QSFSVELFPP KKTDSFDNII NTLDNLNGLD IDFVSVTYGA GGSSRDNTVK        60
     LSKKIKSEYN LEVITHLTCI NSKKDEIASL LDEMKENNLE NILALRGDIP SEVIYDDYKY       120
     ASDLIPEIKS LGDFCVGAAC YPEKHPEAPS NVYDIKKLKQ KTALGCDFLI SQLFLDNTMF       180
     FNFQERLELA DVNTKVLAGI MPVINKAQFE RIIQLSGCNV PPKFKKILEK YEHNPSALKD       240
     AGIAYAIDQI IDLMCHDVDG IHLYIMNKPE NAKRILDNIT GLRNA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page