(data stored in ACNUC7421 zone)

EMBL: CP002160.PE88

CP002160.PE88        Location/Qualifiers
FT   CDS             161810..162925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0090"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: abm:ABSDF1051
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49879"
FT                   /db_xref="GOA:D9SNK8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNK8"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADL49879.1"
FT                   /translation="MTKEQNYIKNRVESLDWLRGLAALSIMLYHLYSWEVAPLYADSLL
FT                   GRFGIYAVSIFFILSGLSMAIVYSDFIKDIKTAIAFLIRRIFRIWPLLWVVTTFNFIIN
FT                   IKSGFSTEQIFVYIANITTIFGFIKPEAYISTGAWSIGNEMVYYVITIIIIMAYRRKKL
FT                   YGNILFVASLIIGYLFAFKFLNPNMELAKQWIIYINPFNNLFFYIGGIAIYYNLKRIDF
FT                   NKYFNNISLCVAMGLFNFIPVCGNQIFITTSIWRVVFSALSFIIVIGFYKLKLDMPKFI
FT                   GKPFELFGIATFGVYLIHPVVYYVIKKLISEKLKLSGYGMMGTIMIIISVSLITILLAL
FT                   VSYYKFELRFMKYGKRYSMISKKEKNRNLSI"
     MTKEQNYIKN RVESLDWLRG LAALSIMLYH LYSWEVAPLY ADSLLGRFGI YAVSIFFILS        60
     GLSMAIVYSD FIKDIKTAIA FLIRRIFRIW PLLWVVTTFN FIINIKSGFS TEQIFVYIAN       120
     ITTIFGFIKP EAYISTGAWS IGNEMVYYVI TIIIIMAYRR KKLYGNILFV ASLIIGYLFA       180
     FKFLNPNMEL AKQWIIYINP FNNLFFYIGG IAIYYNLKRI DFNKYFNNIS LCVAMGLFNF       240
     IPVCGNQIFI TTSIWRVVFS ALSFIIVIGF YKLKLDMPKF IGKPFELFGI ATFGVYLIHP       300
     VVYYVIKKLI SEKLKLSGYG MMGTIMIIIS VSLITILLAL VSYYKFELRF MKYGKRYSMI       360
     SKKEKNRNLS I                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page