(data stored in ACNUC7421 zone)

EMBL: CP002160.PE91

CP002160.PE91        Location/Qualifiers
FT   CDS             complement(165562..166488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0093"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   cbi:CLJ_B0082 LD-carboxypeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49882"
FT                   /db_xref="GOA:D9SNL1"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL1"
FT                   /inference="protein motif:PFAM:PF02016"
FT                   /protein_id="ADL49882.1"
FT                   /translation="MIADKLQLGDTIGIVAPASGERKEIIDNGISCLKKLGFNVKIGNH
FT                   VYDKYGFLAGNDKNRAEDFMAMFLDPEVKMVMCMRGGYGSMRIIDYIDMNIIESNPKIF
FT                   TGFSDITILLNYINKLTGLITFHGPMINSDINDEYTLKSFLSTLTESKATYLLENPDYL
FT                   ALECSVNGIVEGEIVGGNLAMICSSLGTPYEIETTDKILFIEEVGEAPYRIDRMFTQLI
FT                   HSGKLDKCKGFILGQFKDCGLSNYDRSFTLPQVIEDRIFSLNKPTISHFMSGHGNPKIT
FT                   IPIGAKIQLNCNTSEIKVLEPVVKVLS"
     MIADKLQLGD TIGIVAPASG ERKEIIDNGI SCLKKLGFNV KIGNHVYDKY GFLAGNDKNR        60
     AEDFMAMFLD PEVKMVMCMR GGYGSMRIID YIDMNIIESN PKIFTGFSDI TILLNYINKL       120
     TGLITFHGPM INSDINDEYT LKSFLSTLTE SKATYLLENP DYLALECSVN GIVEGEIVGG       180
     NLAMICSSLG TPYEIETTDK ILFIEEVGEA PYRIDRMFTQ LIHSGKLDKC KGFILGQFKD       240
     CGLSNYDRSF TLPQVIEDRI FSLNKPTISH FMSGHGNPKI TIPIGAKIQL NCNTSEIKVL       300
     EPVVKVLS                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page