(data stored in ACNUC7421 zone)

EMBL: CP002160.PE97

CP002160.PE97        Location/Qualifiers
FT   CDS             173019..173657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0099"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: aoe:Clos_0060
FT                   dTMP kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49888"
FT                   /db_xref="GOA:D9SNL7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL7"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADL49888.1"
FT                   /translation="MEGNNRNNRGYLITIEGPDGSGKSTQIELLKKYFNDRGYEVVTTR
FT                   EPGGTKISEKIRELILDNDNEEMNGICEALLYAASRAQLVEQVLKPAIYEGKIVLCDRF
FT                   VHSSLVYQGYARELGVNQVLNINEFALNGLKADLTIMIDIPYELGIERKRKQKKLDRLE
FT                   NGGDEFHNKVFNGYQQIVKTMKNVVIIDGTKAVEEIHKDIVKTIAELNI"
     MEGNNRNNRG YLITIEGPDG SGKSTQIELL KKYFNDRGYE VVTTREPGGT KISEKIRELI        60
     LDNDNEEMNG ICEALLYAAS RAQLVEQVLK PAIYEGKIVL CDRFVHSSLV YQGYARELGV       120
     NQVLNINEFA LNGLKADLTI MIDIPYELGI ERKRKQKKLD RLENGGDEFH NKVFNGYQQI       180
     VKTMKNVVII DGTKAVEEIH KDIVKTIAEL NI                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page