(data stored in ACNUC7421 zone)

EMBL: CP002160.PE98

CP002160.PE98        Location/Qualifiers
FT   CDS             173897..174226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0100"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   cbe:Cbei_0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49889"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNL8"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADL49889.1"
FT                   /translation="MKLVLAIVQDEDVTDVVEELTDANYRVTKLATTGGFLRSGNTTLL
FT                   IGVEEEMVDEVISIIKEECQQRNAVVSAPSSSGGTSSPFLAIPVEIEVGGANIFVVDVD
FT                   KFVRV"
     MKLVLAIVQD EDVTDVVEEL TDANYRVTKL ATTGGFLRSG NTTLLIGVEE EMVDEVISII        60
     KEECQQRNAV VSAPSSSGGT SSPFLAIPVE IEVGGANIFV VDVDKFVRV                   109
//

If you have problems or comments...

PBIL Back to PBIL home page