(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE1

CP002209.PE1         Location/Qualifiers
FT   CDS             298..1704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterPro IPR020591: IPR013159: IPR013317:
FT                   IPR003593: IPR 018312: IPR001957; KEGG: saz:Sama_0013
FT                   chromosomal replication initiation protein; PFAM:
FT                   Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; SPTR: A1S1G9
FT                   Chromosomal replication initiator protein dnaA; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74215"
FT                   /db_xref="GOA:E1SUL0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL0"
FT                   /protein_id="ADN74215.1"
FT                   /translation="MILFWTDNLGAFAVSLPVWQQCVERLRDELPAQQFSMWIRPLQAE
FT                   LMGDTLVLYAPNRFVLDWVRDKYLNSITAFLAETLGDQAPALQFDIGSKPEARPKVDIG
FT                   TPRPAAAVPASPVRTEPPASSNQSVRSNINPNYQFDNFVEGKSNQLARAAASQVADNPG
FT                   GAYNPLFLYGGTGLGKTHLLHAVGNGIMKRKPNAKVVYMHSERFVQDMVKALQNNAIAE
FT                   FKRYYRSVDALLIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVED
FT                   RLKSRFGWGLTVAIEPPELETRVAILMRKAEESNIHLPDEVAFFIAKRLRSNVRELEGA
FT                   LNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKR
FT                   RSRSVARPRQVAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKED
FT                   YANLIRTLSS"
     MILFWTDNLG AFAVSLPVWQ QCVERLRDEL PAQQFSMWIR PLQAELMGDT LVLYAPNRFV        60
     LDWVRDKYLN SITAFLAETL GDQAPALQFD IGSKPEARPK VDIGTPRPAA AVPASPVRTE       120
     PPASSNQSVR SNINPNYQFD NFVEGKSNQL ARAAASQVAD NPGGAYNPLF LYGGTGLGKT       180
     HLLHAVGNGI MKRKPNAKVV YMHSERFVQD MVKALQNNAI AEFKRYYRSV DALLIDDIQF       240
     FANKDRSQEE FFHTFNALLE GNHQIILTSD RYPKEIDGVE DRLKSRFGWG LTVAIEPPEL       300
     ETRVAILMRK AEESNIHLPD EVAFFIAKRL RSNVRELEGA LNRVIANANF TGRPITIDFV       360
     REALRDLLAL QEKLVTIDNI QKTVAEYYKI KVADLLSKRR SRSVARPRQV AMALAKELTN       420
     HSLPEIGDAF GGRDHTTVLH ACRKIEQLRE ESHDIKEDYA NLIRTLSS                    468
//

If you have problems or comments...

PBIL Back to PBIL home page