(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE100

CP002209.PE100       Location/Qualifiers
FT   CDS             complement(124468..124689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3910 hypothetical protein; SPTR:
FT                   A2UXI7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74314"
FT                   /db_xref="GOA:E1SW14"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW14"
FT                   /protein_id="ADN74314.1"
FT                   /translation="MTQQGSAGNVLAAICSFFIAGLGQLVQGRILAAFLFFIFVGGFYA
FT                   LAAVLYVPFIIAIPLHIWCIVDAARYRG"
     MTQQGSAGNV LAAICSFFIA GLGQLVQGRI LAAFLFFIFV GGFYALAAVL YVPFIIAIPL        60
     HIWCIVDAAR YRG                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page