(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE102

CP002209.PE102       Location/Qualifiers
FT   CDS             125667..126197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spl:Spea_3907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74316"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW16"
FT                   /protein_id="ADN74316.1"
FT                   /translation="MKRSIAAVLLSTALLGGCASLTSSGTMLDLAGKTNQEATDALVTA
FT                   LTDKQYKVQRVSGQSLMVEYDNSHFMMQPKLTEDGLDRIVITKYYVLHPDLAQTPELLL
FT                   LIGQLNQRMDFAKFVLIEEGRGVEVRGAATFVDTISVEELTRFMDWTDAGLRALREAFP
FT                   QATPAAKEVRFGA"
     MKRSIAAVLL STALLGGCAS LTSSGTMLDL AGKTNQEATD ALVTALTDKQ YKVQRVSGQS        60
     LMVEYDNSHF MMQPKLTEDG LDRIVITKYY VLHPDLAQTP ELLLLIGQLN QRMDFAKFVL       120
     IEEGRGVEVR GAATFVDTIS VEELTRFMDW TDAGLRALRE AFPQATPAAK EVRFGA           176
//

If you have problems or comments...

PBIL Back to PBIL home page