(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE12

CP002209.PE12        Location/Qualifiers
FT   CDS             complement(16389..18542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0012"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /EC_number="5.1.2.3"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro IPR001753: IPR006176: IPR006108: IPR006180: IPR
FT                   018376: IPR012799; KEGG: saz:Sama_0032 multifunctional
FT                   fatty acid oxidation complex subunit alpha; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; Enoyl-CoA
FT                   hydratase/isomerase; 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; SPTR: A1S1I8 Fatty acid oxidation complex subunit
FT                   alpha; TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase family;
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain;
FT                   TIGRFAM: fatty oxidation complex, alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74226"
FT                   /db_xref="GOA:E1SUM1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM1"
FT                   /protein_id="ADN74226.1"
FT                   /translation="MIFESNALSVDWLEPGIAQMTFDAEGSVNKFDRNTLTHFHNALNV
FT                   LHDLPDLKGLVVASAKGAFIVGADITEFLTLFAEPESVLQHWLEETNLIFNKLEDLPVP
FT                   TIAAINGYALGGGCEAILACDLRVADSSARIGLPETKLGLIPGFGGTVRLPRVIGADNA
FT                   LEWITTGKEHRPDAALQVGAIDAVVAPDALSSAAVAMLKRAIAGEIDWQSRRARKQAPL
FT                   TLSKIEAAMSFTTAKGMVAMKAGPHYPAPHAAVALIEQVSGQGRAEALQGEHAAFIKLA
FT                   KTDVATALIGLFLNDQYVKGKAKKATKLAKPVEQAAVLGAGIMGGGIAYQSAVKGTPVV
FT                   MKDIAQPALDLGLNEAAKLLGKQVERGRLKPDGMAKVLNNIVPSLDYAPVAHADVVVEA
FT                   VVENPKVKGIVLAEVEGVVAEDAVLASNTSTISIDLLAQSLKRPENFCGMHFFNPVHRM
FT                   PLVEVIRGAKTSDETVAKVVAYAAKMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLKEG
FT                   ADFQQIDKVMSKQFGWPMGPAYLLDVVGIDTAHHCLDVMAAGFPERMGKMENDPVDLMF
FT                   KADRYGQKNGKGFFQYAPDRKGKPKKTVDDAALAMLTDAYGAPKSFDAETIIARTMVPM
FT                   INETVRCLEEGIVASPAEADMALLYGIGFPAFRGGIFRYLDTIGLDRFVAMADQYAHLG
FT                   PLYQVTDKLREMAAQGARFYQGQ"
     MIFESNALSV DWLEPGIAQM TFDAEGSVNK FDRNTLTHFH NALNVLHDLP DLKGLVVASA        60
     KGAFIVGADI TEFLTLFAEP ESVLQHWLEE TNLIFNKLED LPVPTIAAIN GYALGGGCEA       120
     ILACDLRVAD SSARIGLPET KLGLIPGFGG TVRLPRVIGA DNALEWITTG KEHRPDAALQ       180
     VGAIDAVVAP DALSSAAVAM LKRAIAGEID WQSRRARKQA PLTLSKIEAA MSFTTAKGMV       240
     AMKAGPHYPA PHAAVALIEQ VSGQGRAEAL QGEHAAFIKL AKTDVATALI GLFLNDQYVK       300
     GKAKKATKLA KPVEQAAVLG AGIMGGGIAY QSAVKGTPVV MKDIAQPALD LGLNEAAKLL       360
     GKQVERGRLK PDGMAKVLNN IVPSLDYAPV AHADVVVEAV VENPKVKGIV LAEVEGVVAE       420
     DAVLASNTST ISIDLLAQSL KRPENFCGMH FFNPVHRMPL VEVIRGAKTS DETVAKVVAY       480
     AAKMGKTPIV VNDCPGFFVN RVLFPYFAGF SLLLKEGADF QQIDKVMSKQ FGWPMGPAYL       540
     LDVVGIDTAH HCLDVMAAGF PERMGKMEND PVDLMFKADR YGQKNGKGFF QYAPDRKGKP       600
     KKTVDDAALA MLTDAYGAPK SFDAETIIAR TMVPMINETV RCLEEGIVAS PAEADMALLY       660
     GIGFPAFRGG IFRYLDTIGL DRFVAMADQY AHLGPLYQVT DKLREMAAQG ARFYQGQ          717
//

If you have problems or comments...

PBIL Back to PBIL home page