(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE123

CP002209.PE123       Location/Qualifiers
FT   CDS             complement(149181..150620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0123"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="COGs: COG3206 Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis; InterPro IPR003856; KEGG:
FT                   pfo:Pfl01_2020 lipopolysaccharide biosynthesis; PFAM:
FT                   lipopolysaccharide biosynthesis protein; SPTR: A3L961
FT                   Putative uncharacterized protein; PFAM: Chain length
FT                   determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74337"
FT                   /db_xref="GOA:E1SW37"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW37"
FT                   /protein_id="ADN74337.1"
FT                   /translation="MQNVSNASWERNAQGTENPLRELVTILFMQKWLIQRVAALVFLAV
FT                   LAVLLFWPSVYQIDSTVLLKSKQVETSPEMLEETMLRVNPVNEDDLNSEVAIITSQAVL
FT                   RRAVNKMVEQGLWQAPEEEADLVKATRGLEAKLTTQVVPSSKVIRISLAWSDPEEGNAL
FT                   LTAVINSYLSYRSTVFEPDTLRDLFTQQTEDYSSQLQQRRAEKMALIETHQAAAPAQEI
FT                   EQNLTLLRELKLQHSRLEQEAQSLNHREQKLTQALNENALHYFSFIDNVTVQKLTTEIQ
FT                   MLVARQTELEQVYLPESPPAEALDHQIEQTYQILRDEIGTLQQELADQVALLRADINSL
FT                   NQKMLTLSQRNVELQQVKLQMERLDQEIKLLGFSYETFYKRREQAQIQSRFSDEHLNAQ
FT                   VVVLVPPEAQLEPLFPRWKTMLPLGLLVALITGVCIGFINEFFDHSFKRAEDSERHLGL
FT                   PTLLSIPQIDAAPQPTAKGHR"
     MQNVSNASWE RNAQGTENPL RELVTILFMQ KWLIQRVAAL VFLAVLAVLL FWPSVYQIDS        60
     TVLLKSKQVE TSPEMLEETM LRVNPVNEDD LNSEVAIITS QAVLRRAVNK MVEQGLWQAP       120
     EEEADLVKAT RGLEAKLTTQ VVPSSKVIRI SLAWSDPEEG NALLTAVINS YLSYRSTVFE       180
     PDTLRDLFTQ QTEDYSSQLQ QRRAEKMALI ETHQAAAPAQ EIEQNLTLLR ELKLQHSRLE       240
     QEAQSLNHRE QKLTQALNEN ALHYFSFIDN VTVQKLTTEI QMLVARQTEL EQVYLPESPP       300
     AEALDHQIEQ TYQILRDEIG TLQQELADQV ALLRADINSL NQKMLTLSQR NVELQQVKLQ       360
     MERLDQEIKL LGFSYETFYK RREQAQIQSR FSDEHLNAQV VVLVPPEAQL EPLFPRWKTM       420
     LPLGLLVALI TGVCIGFINE FFDHSFKRAE DSERHLGLPT LLSIPQIDAA PQPTAKGHR        479
//

If you have problems or comments...

PBIL Back to PBIL home page