(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE124

CP002209.PE124       Location/Qualifiers
FT   CDS             complement(150620..151639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0124"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   pfl:PFL_3082 polysaccharide biosynthesis/export protein;
FT                   PFAM: polysaccharide export protein; Soluble ligand binding
FT                   domain; SPTR: A0ZMF4 Putative uncharacterized protein;
FT                   PFAM: Polysaccharide biosynthesis/export protein; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74338"
FT                   /db_xref="GOA:E1SW38"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW38"
FT                   /protein_id="ADN74338.1"
FT                   /translation="MASSNALFRTLLAALTLFVMSGCATNDFPIGEEVTLSQDTFSFTE
FT                   PEFQILSQYRIVPGDQLDVLFQIQTWSREKAYRISLGDTVSVRFVNAPELDQEQKILPD
FT                   GTVALPYIGAVNVYNKTTDELTAELRAAYSTILRDPQIYVTLPEYLTQIRELKKDLHTA
FT                   SRGLSRLVTVRPDGFVTFPMVGDLYVADRTIQQVNAELNDNYSKISNSLHVDLFLEKHA
FT                   GSQIYVLGEVGKPGAIKISKPTSVAQALAMAGSHSQSARLDHIVVVRRQGKKLVGTRVD
FT                   LDSALQLGAGSSHFYLMPDDVVYVPSTSLATASAVMRQLADVLLLYRGWGFSFRPSDN"
     MASSNALFRT LLAALTLFVM SGCATNDFPI GEEVTLSQDT FSFTEPEFQI LSQYRIVPGD        60
     QLDVLFQIQT WSREKAYRIS LGDTVSVRFV NAPELDQEQK ILPDGTVALP YIGAVNVYNK       120
     TTDELTAELR AAYSTILRDP QIYVTLPEYL TQIRELKKDL HTASRGLSRL VTVRPDGFVT       180
     FPMVGDLYVA DRTIQQVNAE LNDNYSKISN SLHVDLFLEK HAGSQIYVLG EVGKPGAIKI       240
     SKPTSVAQAL AMAGSHSQSA RLDHIVVVRR QGKKLVGTRV DLDSALQLGA GSSHFYLMPD       300
     DVVYVPSTSL ATASAVMRQL ADVLLLYRGW GFSFRPSDN                              339
//

If you have problems or comments...

PBIL Back to PBIL home page