(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE126

CP002209.PE126       Location/Qualifiers
FT   CDS             complement(152789..153649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0126"
FT                   /product="YicC domain protein"
FT                   /note="COGs: COG1561 Uncharacterized stress-induced
FT                   protein; InterPro IPR013551: IPR013527: IPR005229; KEGG:
FT                   slo:Shew_3489 hypothetical protein; PFAM: YicC domain
FT                   protein; domain of unknown function DUF1732; SPTR: A2UXM7
FT                   Putative uncharacterized protein; PFAM: YicC-like family,
FT                   N-terminal region; Domain of unknown function (DUF1732);
FT                   TIGRFAM: conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74340"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW40"
FT                   /protein_id="ADN74340.1"
FT                   /translation="MIHSMTAYGRGELKADWGTASWEIRSVNQRYLETYLRLPEQMRGL
FT                   EPVLRERLRQRLTRGKVEVTLRFDLAQQVDTLNMNESLARQLVEKAQQLHTMAGIGQIQ
FT                   LVDLLKWPGVLESGEQDMDQISQDLLAKFDDVVDDFVDARASEGQALEAMIQQRLEGIS
FT                   TQSAYVRERMPQIMEWQRQKLNDRLADIKEELDPARFEQEMILLAQKMDVAEELDRLDA
FT                   HVAETRKILKKGGACGRRLDFMMQEFNRESNTLASKSISADITAAAVELKVLIEQMREQ
FT                   IQNIE"
     MIHSMTAYGR GELKADWGTA SWEIRSVNQR YLETYLRLPE QMRGLEPVLR ERLRQRLTRG        60
     KVEVTLRFDL AQQVDTLNMN ESLARQLVEK AQQLHTMAGI GQIQLVDLLK WPGVLESGEQ       120
     DMDQISQDLL AKFDDVVDDF VDARASEGQA LEAMIQQRLE GISTQSAYVR ERMPQIMEWQ       180
     RQKLNDRLAD IKEELDPARF EQEMILLAQK MDVAEELDRL DAHVAETRKI LKKGGACGRR       240
     LDFMMQEFNR ESNTLASKSI SADITAAAVE LKVLIEQMRE QIQNIE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page