(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE144

CP002209.PE144       Location/Qualifiers
FT   CDS             167392..167790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0144"
FT                   /product="Glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="COGs: COG0615 Cytidylyltransferase; InterPro
FT                   IPR004820: IPR004821; KEGG: slo:Shew_3695
FT                   cytidyltransferase-like protein; PFAM:
FT                   cytidylyltransferase; SPTR: A0XZ77 Glycerol-3-phosphate
FT                   cytidyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain protein; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   glycerol-3-phosphate cytidylyltransferase;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74358"
FT                   /db_xref="GOA:E1SW58"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW58"
FT                   /protein_id="ADN74358.1"
FT                   /translation="MRIITFGTFDMFHVGHLNILERARSMGDSLVVGVSSDALNFAKKG
FT                   RYPICNQDDRMRILAALACVDKVFVEESLEQKAEYIQRYGADCLVMGDDWSGKFDHLNT
FT                   LCQVQYLPRTPAISTTELIEVVRSAPPR"
     MRIITFGTFD MFHVGHLNIL ERARSMGDSL VVGVSSDALN FAKKGRYPIC NQDDRMRILA        60
     ALACVDKVFV EESLEQKAEY IQRYGADCLV MGDDWSGKFD HLNTLCQVQY LPRTPAISTT       120
     ELIEVVRSAP PR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page