(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE145

CP002209.PE145       Location/Qualifiers
FT   CDS             complement(167787..168896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0145"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: maq:Maqu_0791 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A3JEJ2
FT                   Putative capsular polysaccharide biosynthesis protein;
FT                   PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74359"
FT                   /db_xref="GOA:E1SW59"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW59"
FT                   /protein_id="ADN74359.1"
FT                   /translation="MTPVRVLVIEREYRSNINPIRPEAAQIAALHQTGQVRVTVMCNPG
FT                   SILEDYYRERGIEVIPQPLERKLSLSAIRHIRRVIRSHRIQLLHLFSNTPVSNGATAAI
FT                   GLPVKVIAYRGQTGNIRRFDPSSYLSMLHPRIDKIICVAKAVEQDLARHVRQPEKRLAT
FT                   VYKGHDPSWYQNPPADLSALNLPEGAFTVSLVANLRPRKGLQVLMDATHIWPAGHNIHL
FT                   LLVGAEPDNPKIQQMIANSGCPNQIHPLGWRNDAPEVAAASDLTVLPTLKREGLCRAVL
FT                   EANSYGTPAVMSDTGGNAELVADGETGLIVPPGDARALAEAIYRLYQDPALTARFGAAA
FT                   KQRIIDKFNVEQGVEATLAIYKALAAELA"
     MTPVRVLVIE REYRSNINPI RPEAAQIAAL HQTGQVRVTV MCNPGSILED YYRERGIEVI        60
     PQPLERKLSL SAIRHIRRVI RSHRIQLLHL FSNTPVSNGA TAAIGLPVKV IAYRGQTGNI       120
     RRFDPSSYLS MLHPRIDKII CVAKAVEQDL ARHVRQPEKR LATVYKGHDP SWYQNPPADL       180
     SALNLPEGAF TVSLVANLRP RKGLQVLMDA THIWPAGHNI HLLLVGAEPD NPKIQQMIAN       240
     SGCPNQIHPL GWRNDAPEVA AASDLTVLPT LKREGLCRAV LEANSYGTPA VMSDTGGNAE       300
     LVADGETGLI VPPGDARALA EAIYRLYQDP ALTARFGAAA KQRIIDKFNV EQGVEATLAI       360
     YKALAAELA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page