(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE15

CP002209.PE15        Location/Qualifiers
FT   CDS             20710..22167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0015"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445: IPR004772; KEGG:
FT                   shm:Shewmr7_0019 TrkH family potassium uptake protein;
FT                   PFAM: cation transporter; SPTR: A2V478 Potassium uptake
FT                   protein, TrkH family; TIGRFAM: potassium uptake protein,
FT                   TrkH family; PFAM: Cation transport protein; TIGRFAM:
FT                   potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74229"
FT                   /db_xref="GOA:E1SUM4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM4"
FT                   /protein_id="ADN74229.1"
FT                   /translation="MEYRTITRIIGLLVALFSTTMLPPALIAVIYKDGGGTTFVQAFVL
FT                   SLVLGLLLWYPNRDAKQELRSREGFLIVVLFWTVLGSIGAIPLVLADSPNLSFTDAMFE
FT                   AFSALTTTGATVITGLDNLPKAILFYRHLLQWLGGMGIIVLAVAVLPMLGVGGMQLYRC
FT                   ETPGPVKDNKMTPRIAETAKALWYIYLTLTIACALAYWLAGMNLFDAVGHAFSTVSIGG
FT                   FSSYDASMGHFDSRLINAICVVFLLIAGVNFSLHFTAFGRRGVNLKTYFRDTEVKVFLG
FT                   FQLGVTAICFLVLLNSGIYDSPESTLDHAMFQAVSISTTAGFATQSFSEWPLFLPILLI
FT                   LASFIGGCAGSTGGGMKVVRIVLLLKQGGREVKRLIHPRAMYAIRLNNKAVGDRVIDAV
FT                   WGFFAAYAGLFALFMVALIATGMDDITAFSATVACLNNLGPGLGAVASHFGDITDTAKW
FT                   LLVLAMLFGRLEIFTLLVLFSPAFWKS"
     MEYRTITRII GLLVALFSTT MLPPALIAVI YKDGGGTTFV QAFVLSLVLG LLLWYPNRDA        60
     KQELRSREGF LIVVLFWTVL GSIGAIPLVL ADSPNLSFTD AMFEAFSALT TTGATVITGL       120
     DNLPKAILFY RHLLQWLGGM GIIVLAVAVL PMLGVGGMQL YRCETPGPVK DNKMTPRIAE       180
     TAKALWYIYL TLTIACALAY WLAGMNLFDA VGHAFSTVSI GGFSSYDASM GHFDSRLINA       240
     ICVVFLLIAG VNFSLHFTAF GRRGVNLKTY FRDTEVKVFL GFQLGVTAIC FLVLLNSGIY       300
     DSPESTLDHA MFQAVSISTT AGFATQSFSE WPLFLPILLI LASFIGGCAG STGGGMKVVR       360
     IVLLLKQGGR EVKRLIHPRA MYAIRLNNKA VGDRVIDAVW GFFAAYAGLF ALFMVALIAT       420
     GMDDITAFSA TVACLNNLGP GLGAVASHFG DITDTAKWLL VLAMLFGRLE IFTLLVLFSP       480
     AFWKS                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page