(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE150

CP002209.PE150       Location/Qualifiers
FT   CDS             complement(173249..174508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0150"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="COGs: COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase; InterPro IPR001296: IPR007507; KEGG:
FT                   sbl:Sbal_0060 3-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein; PFAM:
FT                   Three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein; glycosyl transferase group 1; SPTR: A2V3L3
FT                   Three-deoxy-D-manno-octulosonic-acid transferase-like;
FT                   PFAM: Glycosyl transferases group 1;
FT                   3-Deoxy-D-manno-octulosonic-acid transferase
FT                   (kdotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74364"
FT                   /db_xref="GOA:E1SW64"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW64"
FT                   /protein_id="ADN74364.1"
FT                   /translation="MNRLFYSLVLTLLLPVVLAYLLWRSRKAPAYRQRWGERLGLTLPK
FT                   VNDAIVVHCASMGETLAAVPLIEALRARYPDKPVLVTSFTPSGSEQVKQRFGDSVAHAY
FT                   LPLDLPFITRRFIRRVRPAMVVLMETELWPNLIHQCHRQRVPVMLSNARMSERSARGYA
FT                   RFPRLTRPMLGELDAVAAQSAEDGARLVTLGLDPAKLTICGSLKFDLDLSRANLADLRQ
FT                   AREQGFGQRKIWCAGSTHPGEFEQALSAHRALLRLHPDLLLLLVPRHPEQFDHAEALAQ
FT                   QAGFVTARRTGGDSVEESVQVVIGDTMGELLTLYGLADAAFVGGSLIERGGHNPLEPAA
FT                   LGKPVLMGPHFFNFQEIGQALLQAGGMTLVNNADELADQLEHLLSLRKQAEQMGHQGQR
FT                   VVDTNRGATERQLALASSLL"
     MNRLFYSLVL TLLLPVVLAY LLWRSRKAPA YRQRWGERLG LTLPKVNDAI VVHCASMGET        60
     LAAVPLIEAL RARYPDKPVL VTSFTPSGSE QVKQRFGDSV AHAYLPLDLP FITRRFIRRV       120
     RPAMVVLMET ELWPNLIHQC HRQRVPVMLS NARMSERSAR GYARFPRLTR PMLGELDAVA       180
     AQSAEDGARL VTLGLDPAKL TICGSLKFDL DLSRANLADL RQAREQGFGQ RKIWCAGSTH       240
     PGEFEQALSA HRALLRLHPD LLLLLVPRHP EQFDHAEALA QQAGFVTARR TGGDSVEESV       300
     QVVIGDTMGE LLTLYGLADA AFVGGSLIER GGHNPLEPAA LGKPVLMGPH FFNFQEIGQA       360
     LLQAGGMTLV NNADELADQL EHLLSLRKQA EQMGHQGQRV VDTNRGATER QLALASSLL        419
//

If you have problems or comments...

PBIL Back to PBIL home page