(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE151

CP002209.PE151       Location/Qualifiers
FT   CDS             174670..175305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0151"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: slo:Shew_3708 TetR family
FT                   transcriptional regulator; PFAM: regulatory protein TetR;
FT                   SPTR: A2V3L4 Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74365"
FT                   /db_xref="GOA:E1SW65"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW65"
FT                   /protein_id="ADN74365.1"
FT                   /translation="MKTKDRIIEASCELFNEHGERAVTTNHIAAHLGISPGNLYYHFRN
FT                   KEQIIRALFAQYEAYLEEAYGPSDDETAFGVMKRYLDGMFEGMWRFRFLYASLPEILAR
FT                   DPELHKRYLQAHHRVLETATNNLRMLKAQGMMVIDDAYLDEFAEGIKMVVTFWISHLYT
FT                   QALDKPITEQGVSQGVLQILAMFHGYIAEPARADFERLVAHYRALAHG"
     MKTKDRIIEA SCELFNEHGE RAVTTNHIAA HLGISPGNLY YHFRNKEQII RALFAQYEAY        60
     LEEAYGPSDD ETAFGVMKRY LDGMFEGMWR FRFLYASLPE ILARDPELHK RYLQAHHRVL       120
     ETATNNLRML KAQGMMVIDD AYLDEFAEGI KMVVTFWISH LYTQALDKPI TEQGVSQGVL       180
     QILAMFHGYI AEPARADFER LVAHYRALAH G                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page