(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE157

CP002209.PE157       Location/Qualifiers
FT   CDS             178955..179776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0157"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: slo:Shew_3712 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: A2V3L8 Rhomboid-like protein; PFAM:
FT                   Protein of unknown function (DUF3582); Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74371"
FT                   /db_xref="GOA:E1SKX7"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKX7"
FT                   /protein_id="ADN74371.1"
FT                   /translation="MTEVGVLGDPRAAQALVDYLRSQGIEARLLAAEDGYAVMVEDAQH
FT                   HRGREEFERFVADPHNKRYLAASWQSGDAKVQFQYGGGGSLWRSFLSGAGPLTLSLLVV
FT                   VSAIWVFWILGFDQLIFSWTHFFPSWDAMGEGQWWRLFTPSLIHFSAMHVIFNLLWWWY
FT                   LGGRIERVRGTGTLLILLLVAGTLPNLAQFAFSGPNFGGLSGVVYALVGYCWISGRLDP
FT                   RSPLALPPAYVGFLLLWLVMGFAGFMNMANAAHLGGLLVGMAQAVFDRRRQ"
     MTEVGVLGDP RAAQALVDYL RSQGIEARLL AAEDGYAVMV EDAQHHRGRE EFERFVADPH        60
     NKRYLAASWQ SGDAKVQFQY GGGGSLWRSF LSGAGPLTLS LLVVVSAIWV FWILGFDQLI       120
     FSWTHFFPSW DAMGEGQWWR LFTPSLIHFS AMHVIFNLLW WWYLGGRIER VRGTGTLLIL       180
     LLVAGTLPNL AQFAFSGPNF GGLSGVVYAL VGYCWISGRL DPRSPLALPP AYVGFLLLWL       240
     VMGFAGFMNM ANAAHLGGLL VGMAQAVFDR RRQ                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page