(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE161

CP002209.PE161       Location/Qualifiers
FT   CDS             181581..182132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0161"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR007087; KEGG: sse:Ssed_0212 hypothetical
FT                   protein; SPTR: A3T2Y6 Copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74375"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY1"
FT                   /protein_id="ADN74375.1"
FT                   /translation="MTKLYSRAVAVFALALSLTLSPLALANMGHHGDHAAHQAQEAQHC
FT                   PHGKQDGERKGCCGQAKGESCPHAGKGHAAHQGDTHACPMHPKVTGVAGDDCPKCGMKL
FT                   EQVAQADTHVCPMHPKVTGVAGDDCPKCGMKLEQMAQADTHVCPMHPKVTGVAGDDCPK
FT                   CGMKLEPKRGQGGHGHHAHH"
     MTKLYSRAVA VFALALSLTL SPLALANMGH HGDHAAHQAQ EAQHCPHGKQ DGERKGCCGQ        60
     AKGESCPHAG KGHAAHQGDT HACPMHPKVT GVAGDDCPKC GMKLEQVAQA DTHVCPMHPK       120
     VTGVAGDDCP KCGMKLEQMA QADTHVCPMH PKVTGVAGDD CPKCGMKLEP KRGQGGHGHH       180
     AHH                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page