(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE165

CP002209.PE165       Location/Qualifiers
FT   CDS             187605..188210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4292 hypothetical protein; SPTR:
FT                   A3IDJ3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74379"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY5"
FT                   /protein_id="ADN74379.1"
FT                   /translation="MKKLTLTALLVLGLSACGQSETAKQAEAFSALDHKAAVLQGHQWY
FT                   KNNDGIVVRVHPDRVNATFSDGTEADVAIPNGEFYLSIAPWATFTHPCGNHVPTGCTGE
FT                   LIGQPMHVSAVDVDSGEEVINKMITTQHDGFIDFWVPAQRQLAFTFHFDHPKYGMLEAK
FT                   EVLPTFEDSRTCITTMQLKPMDGGAIEAPGQGGHSGHH"
     MKKLTLTALL VLGLSACGQS ETAKQAEAFS ALDHKAAVLQ GHQWYKNNDG IVVRVHPDRV        60
     NATFSDGTEA DVAIPNGEFY LSIAPWATFT HPCGNHVPTG CTGELIGQPM HVSAVDVDSG       120
     EEVINKMITT QHDGFIDFWV PAQRQLAFTF HFDHPKYGML EAKEVLPTFE DSRTCITTMQ       180
     LKPMDGGAIE APGQGGHSGH H                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page