(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE167

CP002209.PE167       Location/Qualifiers
FT   CDS             190016..190510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74381"
FT                   /db_xref="GOA:E1SKY7"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY7"
FT                   /protein_id="ADN74381.1"
FT                   /translation="MQVMAKYLQNVQSRMVISLVMARVLGLMLLALSAMELYRSLGDGD
FT                   VALALMAFTQLYHLTLGLMLLTLAIRLVKQVGQMRLFSVACRQMMVMLARLGLLAAFLV
FT                   KPCGLIVISAVQPELAMDITFLKFVMLVDWPVVVLAGLLHLMAGLQKLGSEMNAEQELT
FT                   I"
     MQVMAKYLQN VQSRMVISLV MARVLGLMLL ALSAMELYRS LGDGDVALAL MAFTQLYHLT        60
     LGLMLLTLAI RLVKQVGQMR LFSVACRQMM VMLARLGLLA AFLVKPCGLI VISAVQPELA       120
     MDITFLKFVM LVDWPVVVLA GLLHLMAGLQ KLGSEMNAEQ ELTI                        164
//

If you have problems or comments...

PBIL Back to PBIL home page