(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE169

CP002209.PE169       Location/Qualifiers
FT   CDS             190721..191242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_2025 choline/carnitine/betaine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74383"
FT                   /db_xref="GOA:E1SKY9"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKY9"
FT                   /protein_id="ADN74383.1"
FT                   /translation="MGPIEIQREIAGHDVKVEVSMWSGRERVLIDGEEVSNTLSWRFTT
FT                   LHQLVLDGRPFEVEVSIQNLWDGRLGVVFRLDGETVGVTRWALSSEASEESDEETNWLA
FT                   DWRLPGWLSALFWLPYLGLIVADMVATFTDQEALLGTVIPPALLLLGALGVALSLTTWI
FT                   RGMTLPTGPN"
     MGPIEIQREI AGHDVKVEVS MWSGRERVLI DGEEVSNTLS WRFTTLHQLV LDGRPFEVEV        60
     SIQNLWDGRL GVVFRLDGET VGVTRWALSS EASEESDEET NWLADWRLPG WLSALFWLPY       120
     LGLIVADMVA TFTDQEALLG TVIPPALLLL GALGVALSLT TWIRGMTLPT GPN              173
//

If you have problems or comments...

PBIL Back to PBIL home page