(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE17

CP002209.PE17        Location/Qualifiers
FT   CDS             complement(22700..23017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0017"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: son:SO_0026 ArsR family
FT                   transcriptional regulator; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: A2V476
FT                   Transcriptional regulator, ArsR family; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74231"
FT                   /db_xref="GOA:E1SUM6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM6"
FT                   /protein_id="ADN74231.1"
FT                   /translation="MALNIDISDMAENAEAASRLLKSIANGHRLMILCLLLEKELTVGE
FT                   LNDKVPLSQSALSQHLAVLRKEGLVSTRKEAQMVWYRLASREVEAILSTLHSIYCAPEA
FT                   L"
     MALNIDISDM AENAEAASRL LKSIANGHRL MILCLLLEKE LTVGELNDKV PLSQSALSQH        60
     LAVLRKEGLV STRKEAQMVW YRLASREVEA ILSTLHSIYC APEAL                       105
//

If you have problems or comments...

PBIL Back to PBIL home page