(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE170

CP002209.PE170       Location/Qualifiers
FT   CDS             complement(191239..192189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0170"
FT                   /product="ferredoxin"
FT                   /note="COGs: COG2871 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit NqrF; InterPro IPR001041: IPR005625;
FT                   KEGG: sse:Ssed_2277 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase, subunit NqrF; PFAM: ferredoxin;
FT                   PepSY-associated TM helix domain protein; SPTR: A3WJN9
FT                   Na+-transporting NADH:ubiquinone oxidoreductase, subunit
FT                   NqrF; PFAM: 2Fe-2S iron-sulfur cluster binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74384"
FT                   /db_xref="GOA:E1SKZ0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ0"
FT                   /protein_id="ADN74384.1"
FT                   /translation="MMRWHKWAALAVGLQMMVWIGTGLYFNLVDHQRIGGHQYHQQAAE
FT                   PTWSLTQLVDPTPLLEQYAPVIRLTLVDRAGHPYYQLEHQRQLYRRQAQTLTLVDAIRG
FT                   DAVTVDRAMASAVARASYRGPGAVSEITALPPHSAELPKEENPAWRVAFADDLATVVFV
FT                   EARSGRLIGHQNRHSREAALMLKLHFMDYANTGGFNHPLMWTFALFSLALSLSGLTLLI
FT                   RRLGSNLSHWRARRVTLHTPAGAQKLRLAPRQSVLEGMQREGLAVRSECGGGGSCGRCR
FT                   IRLEPGSPISAAEQRFLSQRHLEQGWRLACQQYGD"
     MMRWHKWAAL AVGLQMMVWI GTGLYFNLVD HQRIGGHQYH QQAAEPTWSL TQLVDPTPLL        60
     EQYAPVIRLT LVDRAGHPYY QLEHQRQLYR RQAQTLTLVD AIRGDAVTVD RAMASAVARA       120
     SYRGPGAVSE ITALPPHSAE LPKEENPAWR VAFADDLATV VFVEARSGRL IGHQNRHSRE       180
     AALMLKLHFM DYANTGGFNH PLMWTFALFS LALSLSGLTL LIRRLGSNLS HWRARRVTLH       240
     TPAGAQKLRL APRQSVLEGM QREGLAVRSE CGGGGSCGRC RIRLEPGSPI SAAEQRFLSQ       300
     RHLEQGWRLA CQQYGD                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page