(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE171

CP002209.PE171       Location/Qualifiers
FT   CDS             complement(192186..192887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2335 hypothetical protein; SPTR:
FT                   A3WJP0 Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74385"
FT                   /db_xref="GOA:E1SKZ1"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ1"
FT                   /protein_id="ADN74385.1"
FT                   /translation="MTRSLSPIIQTRRWHRLLMWVIGLQMVIWAISGSYFALMNIHFIH
FT                   GDHLVTPPARALSAESYRVPFNDLRARYPDATGFSLTRIAEQPVIQMTIQGQLRLLDPQ
FT                   TGALLPPVSESLAKRIGQQAYQGSGTLSAAPLLTDTAPSELSPRHLPAWRLDYDDWGQT
FT                   SLYISQLSGELVTKRHRYWRWFDQLWYLHILDYDDGEDLNNLLLRTAACLALAGTLSGA
FT                   LLLWFRLRRRS"
     MTRSLSPIIQ TRRWHRLLMW VIGLQMVIWA ISGSYFALMN IHFIHGDHLV TPPARALSAE        60
     SYRVPFNDLR ARYPDATGFS LTRIAEQPVI QMTIQGQLRL LDPQTGALLP PVSESLAKRI       120
     GQQAYQGSGT LSAAPLLTDT APSELSPRHL PAWRLDYDDW GQTSLYISQL SGELVTKRHR       180
     YWRWFDQLWY LHILDYDDGE DLNNLLLRTA ACLALAGTLS GALLLWFRLR RRS              233
//

If you have problems or comments...

PBIL Back to PBIL home page