(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE173

CP002209.PE173       Location/Qualifiers
FT   CDS             complement(193943..196348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0173"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="COGs: COG2217 Cation transport ATPase; InterPro
FT                   IPR000695: IPR001757: IPR006121: IPR008250: IPR 005834:
FT                   IPR018303: IPR017969: IPR006416: IPR006403; KEGG:
FT                   abo:ABO_2353 Cu(I)-exporting ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Q8Z8S4 Copper-exporting
FT                   P-type ATPase A; TIGRFAM: copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase; Heavy-metal-associated domain; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: copper-(or
FT                   silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74387"
FT                   /db_xref="GOA:E1SKZ3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ3"
FT                   /protein_id="ADN74387.1"
FT                   /translation="MTTQLRIEGARCASCVSKIEAALTPIAGVSGVQVNLADQSVEVTG
FT                   EAEPAHLIRALDAIGYPAQLQVENRETIAVPGMRCAGCVSKIEGALRALPGMAQVQVNL
FT                   AEKTVLLTGHYDLANALEALASIGYPGELQETDPTEADAEHLTGFRQQMMQSALALTLG
FT                   LLMMVWGWVDGMTVESWTDQWLWGSAGALTLVMMIYAGGHYFRGAWQALKHGSATMDTL
FT                   IALGTGTAWLFSMGVVLMPEAFPAASRHLYFEASAMIIGLINLGQALEHRAKSKTNTAL
FT                   RQLMALRPKTARVIRDGEEQDIPIRLVQAGDQLRLRPGEQVPVDGVVLEGRSLVDESML
FT                   TGEPMPVEKVPGGDLSAGTLNKQGSLIMSAQRVGADTALAQIIELVRHAQSSKLPIANL
FT                   ANRISAVFVPAVVVIALLSATVWFLWGPDPRLSHALVVLTTVLIIACPCALGLATPMSV
FT                   INGVGKAAQLGLLVREGSALQTATDLTALVVDKTGTLTEGRPSVTDQIPVPGIESPRLL
FT                   IQAAALEQGSEHPLAEAILRAAQKEKLPPLDAFEAHTGLGVEGQVDGQHLILGNHAMMT
FT                   QWQVDTRPLDAEVARLASEGKTPVYLAAEGQLQGVLAIADPIREDAGSAIERLHRQGIK
FT                   VVMLTGDHPDTAAAVARQLGIDQFEAQMRPEDKVRILTSLQQSGDKVAMAGDGINDAPA
FT                   LAQADVGFAIGSGTDIAKASADIILIRSSLHGVADAIALSRATLRNIKQNLFGAFIYNS
FT                   LGIPIAAGVLYPLTGTLLNPVVAGAAMALSSLTVVTNANRLRWFTPRR"
     MTTQLRIEGA RCASCVSKIE AALTPIAGVS GVQVNLADQS VEVTGEAEPA HLIRALDAIG        60
     YPAQLQVENR ETIAVPGMRC AGCVSKIEGA LRALPGMAQV QVNLAEKTVL LTGHYDLANA       120
     LEALASIGYP GELQETDPTE ADAEHLTGFR QQMMQSALAL TLGLLMMVWG WVDGMTVESW       180
     TDQWLWGSAG ALTLVMMIYA GGHYFRGAWQ ALKHGSATMD TLIALGTGTA WLFSMGVVLM       240
     PEAFPAASRH LYFEASAMII GLINLGQALE HRAKSKTNTA LRQLMALRPK TARVIRDGEE       300
     QDIPIRLVQA GDQLRLRPGE QVPVDGVVLE GRSLVDESML TGEPMPVEKV PGGDLSAGTL       360
     NKQGSLIMSA QRVGADTALA QIIELVRHAQ SSKLPIANLA NRISAVFVPA VVVIALLSAT       420
     VWFLWGPDPR LSHALVVLTT VLIIACPCAL GLATPMSVIN GVGKAAQLGL LVREGSALQT       480
     ATDLTALVVD KTGTLTEGRP SVTDQIPVPG IESPRLLIQA AALEQGSEHP LAEAILRAAQ       540
     KEKLPPLDAF EAHTGLGVEG QVDGQHLILG NHAMMTQWQV DTRPLDAEVA RLASEGKTPV       600
     YLAAEGQLQG VLAIADPIRE DAGSAIERLH RQGIKVVMLT GDHPDTAAAV ARQLGIDQFE       660
     AQMRPEDKVR ILTSLQQSGD KVAMAGDGIN DAPALAQADV GFAIGSGTDI AKASADIILI       720
     RSSLHGVADA IALSRATLRN IKQNLFGAFI YNSLGIPIAA GVLYPLTGTL LNPVVAGAAM       780
     ALSSLTVVTN ANRLRWFTPR R                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page