(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE176

CP002209.PE176       Location/Qualifiers
FT   CDS             complement(197683..198018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0176"
FT                   /product="late embryogenesis abundant protein"
FT                   /note="KEGG: pat:Patl_3865 late embryogenesis abundant
FT                   protein; SPTR: A3JEX6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ6"
FT                   /protein_id="ADN74390.1"
FT                   /translation="MKARISVMAALILMGLTACSEQNKEDLQDAMDKAAAKAEQMKDDA
FT                   QQAANDALDEAKAQADDAYNDAKDAANDAYEDAKGAAQDAVDEAKVQAEEMTEEAKKEA
FT                   EELLEKQ"
     MKARISVMAA LILMGLTACS EQNKEDLQDA MDKAAAKAEQ MKDDAQQAAN DALDEAKAQA        60
     DDAYNDAKDA ANDAYEDAKG AAQDAVDEAK VQAEEMTEEA KKEAEELLEK Q                111
//

If you have problems or comments...

PBIL Back to PBIL home page