(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE177

CP002209.PE177       Location/Qualifiers
FT   CDS             198157..199077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0177"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001972:
FT                   IPR001107: IPR018080; KEGG: ttu:TERTU_1892 SPFH/band 7
FT                   domain protein; PFAM: band 7 protein; SMART: band 7
FT                   protein; SPTR: P0AA56 Protein qmcA; PFAM: SPFH domain /
FT                   Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74391"
FT                   /db_xref="GOA:E1SKZ7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ7"
FT                   /protein_id="ADN74391.1"
FT                   /translation="MFGSEIVALVLVGLAVILVATGVKMVPQGFQYTVERFGKFTRTLS
FT                   PGLNLIVPLVDTIGKKQNMMEQVLDIMPQEVISADNAQVTTDAVCFYQVQDPVRASYEV
FT                   NNLELAMQNLVMTNIRAVLGAMELDEMLSNRDRINAELLIKVDEATDPWGVKVTRIEIR
FT                   DISPPRDLVDAMARQMKAEREKRAAILEAEGEREAAIKVAEGEKQSAILKAEGQLEAAK
FT                   REAEARERLAEAEAAATTMVSKAIAEGDMQAINYFVAQKYVEAVKEVASAENSKLVMMP
FT                   LEAGNLIGAVGGISELLKETGKRSV"
     MFGSEIVALV LVGLAVILVA TGVKMVPQGF QYTVERFGKF TRTLSPGLNL IVPLVDTIGK        60
     KQNMMEQVLD IMPQEVISAD NAQVTTDAVC FYQVQDPVRA SYEVNNLELA MQNLVMTNIR       120
     AVLGAMELDE MLSNRDRINA ELLIKVDEAT DPWGVKVTRI EIRDISPPRD LVDAMARQMK       180
     AEREKRAAIL EAEGEREAAI KVAEGEKQSA ILKAEGQLEA AKREAEARER LAEAEAAATT       240
     MVSKAIAEGD MQAINYFVAQ KYVEAVKEVA SAENSKLVMM PLEAGNLIGA VGGISELLKE       300
     TGKRSV                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page