(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE178

CP002209.PE178       Location/Qualifiers
FT   CDS             199077..199526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0178"
FT                   /product="protein of unknown function DUF107"
FT                   /note="COGs: COG1585 Membrane protein implicated in
FT                   regulation of membrane protease activity; InterPro
FT                   IPR002810; KEGG: cja:CJA_1077 hypothetical protein; PFAM:
FT                   protein of unknown function DUF107; SPTR: A3H0N8 Putative
FT                   uncharacterized protein; PFAM: NfeD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74392"
FT                   /db_xref="GOA:E1SKZ8"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:E1SKZ8"
FT                   /protein_id="ADN74392.1"
FT                   /translation="MAVLEALEAWHWLVLGLILLGLEALGAGGFLLGAAAAGILLSLLM
FT                   WIWPEMGWSLQLMVFALSAVLFTVIYWRGFRRFNQATEQPQLNDRAAQLVGRVLVLEHD
FT                   LLPGEGKIQVGDTLWRARTEQPLAAGSRVRIVASEGMVLQLEAAQ"
     MAVLEALEAW HWLVLGLILL GLEALGAGGF LLGAAAAGIL LSLLMWIWPE MGWSLQLMVF        60
     ALSAVLFTVI YWRGFRRFNQ ATEQPQLNDR AAQLVGRVLV LEHDLLPGEG KIQVGDTLWR       120
     ARTEQPLAAG SRVRIVASEG MVLQLEAAQ                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page