(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE183

CP002209.PE183       Location/Qualifiers
FT   CDS             204987..205610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0183"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="COGs: COG1974 SOS-response transcriptional
FT                   repressors (RecA-mediated autopeptidase); InterPro
FT                   IPR006197: IPR006199: IPR019759: IPR006200; KEGG:
FT                   slo:Shew_0127 LexA repressor; PFAM: LexA DNA-binding domain
FT                   protein; Peptidase S24/S26A/S26B, conserved region; PRIAM:
FT                   Repressor lexA; SPTR: A3Q951 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA binding domain; Peptidase
FT                   S24-like; TIGRFAM: SOS regulatory protein LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74397"
FT                   /db_xref="GOA:E1SL03"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL03"
FT                   /protein_id="ADN74397.1"
FT                   /translation="MKPLTPRQNQVFDLVRQHMQDTGMPPTRAEIARQLGFKSANAAEE
FT                   HLKALARKGFIEIVPGTSRGIRLLYNEPEPEQLGLPLIGRVAAGEPILAQEHVETHYQM
FT                   DGNLFRPSANYLLRVRGDSMKEIGILDGDLLAVHQTQDARNGQVVVARVGEDEVTVKRF
FT                   ERRGNVVYLHAENAEYEPIVVDLEDTALAIEGLAVGVVRNGGWQ"
     MKPLTPRQNQ VFDLVRQHMQ DTGMPPTRAE IARQLGFKSA NAAEEHLKAL ARKGFIEIVP        60
     GTSRGIRLLY NEPEPEQLGL PLIGRVAAGE PILAQEHVET HYQMDGNLFR PSANYLLRVR       120
     GDSMKEIGIL DGDLLAVHQT QDARNGQVVV ARVGEDEVTV KRFERRGNVV YLHAENAEYE       180
     PIVVDLEDTA LAIEGLAVGV VRNGGWQ                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page