(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE184

CP002209.PE184       Location/Qualifiers
FT   CDS             205610..206065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3863 hypothetical protein; SPTR:
FT                   A2V2G6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74398"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL04"
FT                   /protein_id="ADN74398.1"
FT                   /translation="MKTRQGVRREHPGLWQQPGLDWQQVQTAPQGDDAGRLALARLAPQ
FT                   LADYSRAPRWLLLINPPAFDWKTVLADAGVDLSRVLQVRCDDDVAAQWALEQAVSGTTC
FT                   AVALAWVPQLDARDRRRLELVSRRAHCPAFLFEVGQGSPLEIPSALH"
     MKTRQGVRRE HPGLWQQPGL DWQQVQTAPQ GDDAGRLALA RLAPQLADYS RAPRWLLLIN        60
     PPAFDWKTVL ADAGVDLSRV LQVRCDDDVA AQWALEQAVS GTTCAVALAW VPQLDARDRR       120
     RLELVSRRAH CPAFLFEVGQ GSPLEIPSAL H                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page