(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE188

CP002209.PE188       Location/Qualifiers
FT   CDS             209771..210643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0188"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: swp:swp_4826
FT                   cytochrome c oxidase, subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; PRIAM: Cytochrome-c oxidase; SPTR:
FT                   A0Y469 Cytochrome c oxidase subunit III; PFAM: Cytochrome c
FT                   oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74402"
FT                   /db_xref="GOA:E1SL08"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL08"
FT                   /protein_id="ADN74402.1"
FT                   /translation="MSQHERYYVPAQSPWPIVGAVGLFLIALGAGNYVASLSKGGGMGG
FT                   YVLLAGIAVILFMMVGWFRNVIDESMSGLYSRQMDRSFRQGMSWFIFSEVMFFAAFFGA
FT                   LFYARMVAIPWLGGAGNNAMTSEVLWPAFEAVWPLETTPDGTQTQAMGWSGLPLYNTII
FT                   LVISSVTLHVAHVGLEQNKRKVLTGWLGLTILLGAAFLFLQVEEYVHAYNEMGLTLDAG
FT                   IYGNTFFLLTGFHGMHVTLGTIMLIVMFFRVLKGHFTPENHFGFQATSWYWHFVDVVWI
FT                   CLFVFVYVL"
     MSQHERYYVP AQSPWPIVGA VGLFLIALGA GNYVASLSKG GGMGGYVLLA GIAVILFMMV        60
     GWFRNVIDES MSGLYSRQMD RSFRQGMSWF IFSEVMFFAA FFGALFYARM VAIPWLGGAG       120
     NNAMTSEVLW PAFEAVWPLE TTPDGTQTQA MGWSGLPLYN TIILVISSVT LHVAHVGLEQ       180
     NKRKVLTGWL GLTILLGAAF LFLQVEEYVH AYNEMGLTLD AGIYGNTFFL LTGFHGMHVT       240
     LGTIMLIVMF FRVLKGHFTP ENHFGFQATS WYWHFVDVVW ICLFVFVYVL                  290
//

If you have problems or comments...

PBIL Back to PBIL home page