(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE191

CP002209.PE191       Location/Qualifiers
FT   CDS             211730..212284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_0172 hypothetical protein; SPTR:
FT                   A2V2H3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74405"
FT                   /db_xref="GOA:E1SL11"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL11"
FT                   /protein_id="ADN74405.1"
FT                   /translation="MNSHNNGTAKRTLWLLLGAFILPVVLAYLYLTQGWYQSGATNKGQ
FT                   LLNNLSYQSLAVSNPAERQWQVITLLPAHCDSNCQDRLATLRQTHIALGREQDRVVPLV
FT                   YLTDQSDPDIRGELASQALRAAGAEMPVQQALADVAMVVVDPLGQWVMAYPAVQGTEAQ
FT                   IQQGRDLLSDLRKLLKLSRIG"
     MNSHNNGTAK RTLWLLLGAF ILPVVLAYLY LTQGWYQSGA TNKGQLLNNL SYQSLAVSNP        60
     AERQWQVITL LPAHCDSNCQ DRLATLRQTH IALGREQDRV VPLVYLTDQS DPDIRGELAS       120
     QALRAAGAEM PVQQALADVA MVVVDPLGQW VMAYPAVQGT EAQIQQGRDL LSDLRKLLKL       180
     SRIG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page