(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE198

CP002209.PE198       Location/Qualifiers
FT   CDS             218058..220568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0198"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="InterPro IPR006025; KEGG: swd:Swoo_0158 peptidase
FT                   M14 carboxypeptidase A; SPTR: A0Y488 Putative
FT                   uncharacterized protein; PFAM: Zinc carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74412"
FT                   /db_xref="GOA:E1SL18"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL18"
FT                   /protein_id="ADN74412.1"
FT                   /translation="MKKLISIGALLLALAIPSVTASPLATLAPDTPYLDTLPTPTQHFG
FT                   GSVGERHLRYDEVSAYFHRLANNSGRVTLENIGFSHQGRPQWAAIITSEANHQRLDDLL
FT                   AQRARAAAGDRVDGPVVIWLAYSIHGDEASGLHASPLFAYHLAAGQSVEVKNWLEDAIV
FT                   VITPSQNPDGNDRFSNWVNGYRGSVPSGHNYHREHFQGWPSGRVNHFWADLNRDWLYQA
FT                   HPESRGRVAFFQRWLPHVVSDYHEMGHQSSYFFQPGVPDRTHPLTPAENQALTARIAKH
FT                   HARALDALYQPYFSRESFDDFYYGKGSTYPDINGSVGILFEQATARGLHRDSDYGEVTL
FT                   ALGVRNHLATSFSTVRGAIAEADALREYQRQFFRDALDKADDRRGAGYLVSARGDRARL
FT                   NAFADILRSHRVQFQYLTAAVQQDEIAFAAGDLFIPFEQPQYRLIEALFDQRTAFADNT
FT                   FYDVSAFSAELAFDLTRAEVRRAPRTQPMAPALPKIDYQQPALQWLIPWQDRLAPAALN
FT                   RLLEAGFRVRFAETGGQVMARQGALDYQAGALTLLGNQPGLAQALSQIEAELGVQAHPL
FT                   VSGQALAGSDLGSRRFHAATAVKPAILIGRDVSQYEAGMLWFYLDQVLGIETVLLDGEY
FT                   FTRAPLQEFTHLFLVDGAYSKLTGAKAAIEPFVRQGGTVVAWKRGVARLAQWGLVDVTV
FT                   RQRSYFAPEFAHAGEQLAFAQRNSEHARRTIGGAIVNWQLDTTHPLGFGLSAELPMMKN
FT                   RELSLAAKESKGRSVAHYPEALLRSGYMAPEYQKALAGEVAAQVMGQGAGQYILMADNP
FT                   LFRNFWLGSERLVANSLFMVPALN"
     MKKLISIGAL LLALAIPSVT ASPLATLAPD TPYLDTLPTP TQHFGGSVGE RHLRYDEVSA        60
     YFHRLANNSG RVTLENIGFS HQGRPQWAAI ITSEANHQRL DDLLAQRARA AAGDRVDGPV       120
     VIWLAYSIHG DEASGLHASP LFAYHLAAGQ SVEVKNWLED AIVVITPSQN PDGNDRFSNW       180
     VNGYRGSVPS GHNYHREHFQ GWPSGRVNHF WADLNRDWLY QAHPESRGRV AFFQRWLPHV       240
     VSDYHEMGHQ SSYFFQPGVP DRTHPLTPAE NQALTARIAK HHARALDALY QPYFSRESFD       300
     DFYYGKGSTY PDINGSVGIL FEQATARGLH RDSDYGEVTL ALGVRNHLAT SFSTVRGAIA       360
     EADALREYQR QFFRDALDKA DDRRGAGYLV SARGDRARLN AFADILRSHR VQFQYLTAAV       420
     QQDEIAFAAG DLFIPFEQPQ YRLIEALFDQ RTAFADNTFY DVSAFSAELA FDLTRAEVRR       480
     APRTQPMAPA LPKIDYQQPA LQWLIPWQDR LAPAALNRLL EAGFRVRFAE TGGQVMARQG       540
     ALDYQAGALT LLGNQPGLAQ ALSQIEAELG VQAHPLVSGQ ALAGSDLGSR RFHAATAVKP       600
     AILIGRDVSQ YEAGMLWFYL DQVLGIETVL LDGEYFTRAP LQEFTHLFLV DGAYSKLTGA       660
     KAAIEPFVRQ GGTVVAWKRG VARLAQWGLV DVTVRQRSYF APEFAHAGEQ LAFAQRNSEH       720
     ARRTIGGAIV NWQLDTTHPL GFGLSAELPM MKNRELSLAA KESKGRSVAH YPEALLRSGY       780
     MAPEYQKALA GEVAAQVMGQ GAGQYILMAD NPLFRNFWLG SERLVANSLF MVPALN           836
//

If you have problems or comments...

PBIL Back to PBIL home page