(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE20

CP002209.PE20        Location/Qualifiers
FT   CDS             complement(25219..26619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0020"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR006036: IPR006037: IPR003148; KEGG:
FT                   saz:Sama_0040 potassium transporter peripheral membrane
FT                   component; PFAM: TrkA-N domain protein; TrkA-C domain
FT                   protein; SPTR: A2V473 TrkA-N; PFAM: TrkA-N domain; TrkA-C
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74234"
FT                   /db_xref="GOA:E1SUM9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUM9"
FT                   /protein_id="ADN74234.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDIAALRALQDKLDL
FT                   RVVHGHAGFPHVLRDAGAEDADMLIAVTNSDDTNMVACHLAYTLYGTPTKIARIRSPAY
FT                   LSKRAELFQSGGADPDSRGRFFIDELIAPEQLVTNYIRRLVEYPGALQVLEFADGKASL
FT                   VAVKAYYGGSLVGSALSALKEHMPNIDTRVAAIFRQGRPIMPRGTTVIEADDEVFFVAD
FT                   SKHIRAVMSEMQKLESSYRNIMIAGGGNIGFGLAKALEPFHEVKLIERNAERASQLSEY
FT                   LEDTTVFHGDASDQELLSDEQISQVDVFIAVTNDDEANIMSALLAKRMGAKKVMVLIQR
FT                   EAYVDLVQDANIDIAISPQQATISALLTHVRQGDINNVYSLRRGAAEAIEAVAHGDPST
FT                   SKVVGRQVQEIKLPPGTTIGAIVRRDEVMMAHDRTVIEQDDHVILFLVDKKHIREVEKL
FT                   FQPSALFI"
     MKIIILGAGQ VGGTLAENLV GENNDITIVD NDIAALRALQ DKLDLRVVHG HAGFPHVLRD        60
     AGAEDADMLI AVTNSDDTNM VACHLAYTLY GTPTKIARIR SPAYLSKRAE LFQSGGADPD       120
     SRGRFFIDEL IAPEQLVTNY IRRLVEYPGA LQVLEFADGK ASLVAVKAYY GGSLVGSALS       180
     ALKEHMPNID TRVAAIFRQG RPIMPRGTTV IEADDEVFFV ADSKHIRAVM SEMQKLESSY       240
     RNIMIAGGGN IGFGLAKALE PFHEVKLIER NAERASQLSE YLEDTTVFHG DASDQELLSD       300
     EQISQVDVFI AVTNDDEANI MSALLAKRMG AKKVMVLIQR EAYVDLVQDA NIDIAISPQQ       360
     ATISALLTHV RQGDINNVYS LRRGAAEAIE AVAHGDPSTS KVVGRQVQEI KLPPGTTIGA       420
     IVRRDEVMMA HDRTVIEQDD HVILFLVDKK HIREVEKLFQ PSALFI                      466
//

If you have problems or comments...

PBIL Back to PBIL home page